Primary Antibodies

Jump to Filters
View as table Download
MBD4 Rabbit Polyclonal Antibody
TA309742

USD 550.00

5 Days

Rabbit Polyclonal MBD4 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MBD4 protein (between residues 200-250) [UniProt O95243]
MBD4 Rabbit Polyclonal Antibody
TA347242

USD 430.00

5 Days

Rabbit Polyclonal MBD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: human MBD4 (Methyl-CpG-binding domain protein 4), using three different KLH-conjugated synthetic peptides.
MBD4 Rabbit Polyclonal Antibody
TA338199

USD 539.00

5 Days

Rabbit Polyclonal Anti-MBD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
MBD4 Rabbit Polyclonal Antibody
TA361260

USD 539.00

5 Days

MBD4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD4
MBD4 Rabbit Polyclonal Antibody
TA361912

USD 539.00

5 Days

MBD4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD4