Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TIRAP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Goat Polyclonal Antibody against TIRAP (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGEGERDSATVSDL, from the C Terminus of the protein sequence according to NP_683708.1.

Goat Polyclonal Antibody against TIRAP (Internal Region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QTLLKKPKKRPNSPE, from the internal region of the protein sequence according to NP_001034750.1; NP_683708.1.

Rabbit Polyclonal Anti-TIRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW