Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-ACPP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Anti-ACPP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Anti-TYR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
Rabbit Polyclonal Anti-ACP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACP2 |
TYR Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TYR |
Rabbit Polyclonal Anti-MTMR7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL |
Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase |
PHPT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PHPT1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Riboflavin metabolism