Primary Antibodies

View as table Download

Rabbit polyclonal antibody to p21-ARC (actin related protein 2/3 complex, subunit 3, 21kDa)

Applications IHC, WB
Reactivities Human (Predicted: Pig, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 178 of p21-ARC (Uniprot ID#O15145)

Goat Polyclonal Antibody against ARPC3

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RQFMNKSLSGPGQ, from the C Terminus of the protein sequence according to NP_005710.

Rabbit Polyclonal Anti-ARPC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3. Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Rabbit Polyclonal Anti-ARPC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the middle region of human ARPC3. Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP