Primary Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody
AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
HCLS1 Rabbit Polyclonal Antibody
TA329699

USD 539.00

5 Days

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
HCLS1 Rabbit Polyclonal Antibody
TA329700

USD 485.00

5 Days

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA330025

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA330026

USD 485.00

5 Days

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG
c Abl (ABL1) Rabbit Polyclonal Antibody
AP20540PU-N

USD 465.00

3 Weeks

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313136

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
AP20705PU-N

USD 465.00

3 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Abl (ABL1) pTyr393/439 Rabbit Polyclonal Antibody
AP20818PU-N

USD 445.00

3 Weeks

c Abl (ABL1) pTyr393/439 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human ABL1/2 around the phosphorylation site of Tyrosine 393/439.
beta Catenin (CTNNB1) pSer37 Rabbit Polyclonal Antibody
AP20827PU-N

USD 445.00

3 Weeks

beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Abl (ABL1) pTyr412 Rabbit Polyclonal Antibody
AP20872PU-N

USD 495.00

3 Weeks

c Abl (ABL1) pTyr412 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Abl (ABL1) Rabbit Polyclonal Antibody
TA312758

USD 380.00

4 Weeks

Rabbit polyclonal anti-ABL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABL1.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313140

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific
HCLS1 Rabbit Polyclonal Antibody
TA314002

USD 380.00

In Stock

Rabbit polyclonal HS1 (Ab-397) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HCLS1.