Primary Antibodies

Jump to Filters
View as table Download
TSG101 (201-281) Mouse Monoclonal Antibody [Clone ID: 5B7]
AM31014PU-N

USD 535.00

2 Weeks

TSG101 (201-281) mouse monoclonal antibody, clone 5B7, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
TSG101 Rabbit Polyclonal Antibody
TA343598

USD 485.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
MDM2 Mouse Monoclonal Antibody [Clone ID: OTI4B3]
CF801588

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications WB
Reactivities Human
Conjugation Unconjugated
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
TSG101 Rabbit Polyclonal Antibody
TA333922

USD 539.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR
PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA323360

USD 380.00

In Stock

Anti-PARD6A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans)