Primary Antibodies

View as table Download

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.

Rabbit polyclonal NR1H3 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3.

Rabbit Polyclonal UCP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession.

Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1

Rabbit Polyclonal Anti-UCP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UCP1

Goat Polyclonal Antibody against SORBS1

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1.

Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346)