Primary Antibodies

Jump to Filters
View as table Download
Superoxide Dismutase 1 (SOD1) Goat Polyclonal Antibody
TA302692

USD 520.00

5 Days

Goat Polyclonal Antibody against SOD1

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1.
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA312441

USD 380.00

4 Weeks

Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Caspase 3.
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA318695

USD 500.00

In Stock

NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913).
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA590292

USD 482.00

In Stock

Rabbit Polyclonal Caspase 8 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Caspase 3 (CASP3) (full length) Rabbit Polyclonal Antibody
AP22764PU-N

USD 555.00

2 Weeks

Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast
Conjugation Unconjugated
Immunogen Recombinant human Caspase-3 protein (full length)
BDNF Rabbit Polyclonal Antibody
AP23288PU-N

USD 560.00

2 Weeks

BDNF rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the middle region of human BDNF
Superoxide Dismutase 1 (SOD1) (Center) Rabbit Polyclonal Antibody
AP18205PU-N

USD 580.00

2 Weeks

Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SOD1
UQCRC2 Rabbit Polyclonal Antibody
TA338233

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV
SOD2 Rabbit Polyclonal Antibody
TA347888

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-sod2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2