Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CX3CL1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure (> 98%) E.coli derived recombinant Human Fractalkine (Cat.-No PA057). |
CX3CL1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure (> 98%) E.coli derived recombinant Human Fractalkine (Cat.-No PA057). |
Rabbit Polyclonal CX3CL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 . |
CX3CL1 / fractalkine (aa214-226) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (KTSEAPSTQDPST) |
Rabbit Polyclonal Anti-CX3CL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ |
CX3CL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1 |
CX3CL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1 |
CX3CL1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant Human Fractalkine (Cat.-No PA057) |
CX3CL1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant Human Fractalkine (Cat.-No PA057) |
CX3CL1 chicken polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic C-terminal peptide coupled to carrier protein. The immunizing sequence is > 90% identical with the corresponding mouse and rat sequences. |
Active filters
Category
- Antibodies
Target Symbol
- CX3CL1