Germany
Japan
United Kingdom
China
OSMR goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_003990.1. |
Primary Antibodies
View as table Download
Anti-OSMR Reference Antibody (vixarelimab)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human, Cynomolgus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OSMR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the N terminal of human OSMR. Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ |
Rabbit Polyclonal Anti-OSMR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the middle region of human OSMR. Synthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
OSMR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- OSMR