MYL9 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MYL9 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MYL9 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MYL9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory |
Anti-MYL9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory |
MYL9 mouse monoclonal antibody,clone OTI3H6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MYL9 mouse monoclonal antibody,clone OTI3H6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MYL9 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2). |
Modifications | Unmodified |
MYL9 (12-27) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated. |
MYL9 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-Myosin antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 12-27 of human myosin light chain protein. |
Rabbit Polyclonal Anti-MYL9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF |
Phospho-MYL9-T18/S19 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around of human Phospho-MYL9-T18/S19 . |
Modifications | Phospho T18/S19 |
MYL9 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 95-125aa) of human MYL9 |
Phospho-MYL9-S19 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S19 of human Phospho-MYL9-S19 (NP_006088.2). |
Modifications | Phospho S19 |
Phospho-Myosin Light Chain 2-S19 Rabbit mAb
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S19 of human Myosin Light Chain 2. |