Primary Antibodies

Jump to Filters
View as table Download
Eomes Rabbit Polyclonal Antibody
TA342257

USD 539.00

In Stock

Rabbit Polyclonal Anti-Eomes Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Eomes antibody: synthetic peptide directed towards the C terminal of human Eomes. Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
Eomes Rabbit Polyclonal Antibody
TA355928

USD 539.00

5 Days

Eomes Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse