Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Polyclonal Antibody against AICDA
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RRKFLYQFKNVR-C, from the N Terminus of the protein sequence according to NP_065712.1. |
AICDA Antibody N-terminal region
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
