CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CD79A Rabbit monoclonal antibody,clone OTIR5E2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody,clone 5E2, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
CD79A mouse monoclonal antibody,clone 5E2, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit Polyclonal Anti-HAO1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
Mouse Monoclonal CD79a Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD79A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG |