Rabbit Polyclonal RICK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | RICK antibody was raised against a peptide corresponding to 20 amino acids near the amino terminus of human RICK. The immunogen is located within the first 50 amino acids of RICK. |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal RIPK2 (Ab-176) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
RIP2 (RIPK2) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between aa 458 - 488 from the C-terminal region of human RIPK2. |
Rabbit Polyclonal Anti-RIPK2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2. Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
Rabbit anti-RIPK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RIPK2 |
Rabbit Polyclonal Anti-Phospho-RIPK2(Ser176) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-RIPK2(Ser176) Antibody: A synthesized peptide derived from human RIPK2 around the phosphorylation site of Sersine 176 |
| Modifications | Phospho-specific |
RIPK2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RIPK2 |
Germany
Japan
United Kingdom
China
