Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CHST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST2 antibody: synthetic peptide directed towards the middle region of human CHST2. Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

CHST2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 312-339 amino acids from the Central region of human CHST2

Rabbit polyclonal anti-CHST2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST2.