Primary Antibodies

View as table Download

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PPP1CA Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS

PPP1CA Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PPP1CA

Mouse Monoclonal PPP1A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal PPP1A Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated