Primary Antibodies

View as table Download

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.

Rabbit Polyclonal Anti-ELOVL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region ( between 270-299aa) of human ELOVL5.

Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%).

ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 247-277 amino acids from the C-terminal region of Human ELOVL5.