Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2.

Rabbit polyclonal anti-DVL2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2.

Rabbit Polyclonal Anti-DVL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ

DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated