Primary Antibodies

View as table Download

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated