Rabbit Polyclonal Anti-LYN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LYN |
Rabbit Polyclonal Anti-LYN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LYN |
Rabbit polyclonal LYN Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-62 amino acids from the N-terminal region of human LYN. |
Rabbit Polyclonal Anti-LYN Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYN antibody: synthetic peptide directed towards the N terminal of human LYN. Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF |
Rabbit Polyclonal Lyn (Tyr507) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lyn around the phosphorylation site of Tyrosine 507 |
Modifications | Phospho-specific |
Rabbit Polyclonal Lyn Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Lyn Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lyn |
Goat Polyclonal Antibody against LYN
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KTQPVRNTERT, from the internal region of the protein sequence according to NP_002341.1. |