Germany
Japan
United Kingdom
China
GFAP rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | GFAP isolated from Cow spinal cord |
Primary Antibodies
View as table Download
Albumin rabbit polyclonal antibody, FITC
| Applications | ID, IF, IP, R |
| Reactivities | Guinea Pig |
| Conjugation | FITC |
| Immunogen | Albumin is isolated from Guinea Pig serum by sequential precipitation and purified by ion exchange chromatography and affinity chromatography. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Goat Anti-Decorin Antibody
| Applications | WB |
| Reactivities | Human, Cow, Pig, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KISRVDAASLKGLNN, from the internal region of the protein sequence according to NP_001911.1; NP_598011.1; NP_598012.1;. |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig (Predicted: Bat) |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Anti-RBPMS Antibody
| Applications | FC, ICC, IHC, WB |
| Reactivities | Feline, Guinea Pig, Pig, Human, Mouse, Rabbit, Rat, Tree Shrew, Whale, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region of rat RBPMS, conjugated to keyhole limpet hemocyanin (KLH). |
GFAP rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Human GFAP. |
PPAR gamma (PPARG) (Isoform 1) rabbit polyclonal antibody, Purified
| Applications | ELISA |
| Reactivities | Canine, Guinea Pig, Hamster, Human, Mink, Monkey, Mouse, Rabbit, Rat, Duck |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 255 - 268 of human PPAR gamma isoform 1. |
GJA1 pSer368 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within connexin43 which includes phosphorylated Ser368 |
Active filters
Filter by
Target Symbol
- C3 (3)
- GFAP (3)
- GLG1 (2)
- HRH3 (2)
- HSP70-1A (2)
- ACTIN (1)
- AE2 (1)
- ALB (1)
- ALPHA 1A ADRENERGIC RECEPTOR (1)
- BETA ACTIN (1)
- CALCA (1)
- CCKAR (1)
- CRLR (1)
- DCXR (1)
- DECORIN (1)
- DOPA DECARBOXYLASE (1)
- EAAT1 (1)
- FAM86A (1)
- GIRK1 (1)
- GIRK2 (1)
- GJA1 (1)
- GPX4 (1)
- KCNH2 (1)
- MUSCARINIC ACETYLCHOLINE RECEPTOR M3 (1)
- NEUROPEPTIDE Y (1)
- NQO1 (1)
- PCK2 (1)
- PPARG (1)
- PTBP1 (1)
- RAMP1 (1)
- RBPMS (1)
- RHOC (1)
- TM9SF3 (1)
- VEGFA (1)
- WNT7A (1)
Antibody Hosts
Clonalities
Conjugates
Assay Types
Families
Pathways
- Neuroactive ligand-receptor interaction (6)
- Calcium signaling pathway (3)
- Metabolic pathways (3)
- Vascular smooth muscle contraction (3)
- Adipocytokine signaling pathway (2)
- Antigen processing and presentation (2)
- Cell adhesion molecules (CAMs) (2)
- Endocytosis (2)
- Focal adhesion (2)
- MAPK signaling pathway (2)
- Pathways in cancer (2)
- Prion diseases (2)
- Regulation of actin cytoskeleton (2)
- Spliceosome (2)
- Adherens junction (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Citrate cycle (TCA cycle) (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Glycolysis / Gluconeogenesis (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Melanogenesis (1)
- PPAR signaling pathway (1)
- Pancreatic cancer (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Pyruvate metabolism (1)
- Renal cell carcinoma (1)
- TGF-beta signaling pathway (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- mTOR signaling pathway (1)