Primary Antibodies

View as table Download

Anti-SLC8A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 33-47 amino acids of Human solute carrier family 8 (sodium/calcium exchanger), member 3

Rabbit Polyclonal Anti-SLC8A3 Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC8A3

Anti-SLC8A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 33-47 amino acids of Human solute carrier family 8 (sodium/calcium exchanger), member 3

Rabbit Polyclonal Anti-SLC8A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC8A3 Antibody: synthetic peptide directed towards the N terminal of human SLC8A3. Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE