Primary Antibodies

View as table Download

ZNF384 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 538-567 amino acids from the C-terminal region of human ZNF384

Rabbit Polyclonal anti-ZNF384 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF384 antibody: synthetic peptide directed towards the middle region of human ZNF384. Synthetic peptide located within the following region: KKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQ

ZNF384 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF384 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF384