Rabbit polyclonal anti-CCNA2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCNA2 |
Rabbit polyclonal anti-CCNA2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCNA2 |
Rabbit Polyclonal Cyclin A2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-CCNA2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCNA2 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-Cyclin A antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-Cyclin-A Antibody was produced by repeated immunizations with a recombinant protein corresponding to the human cyclin A. |
Rabbit Polyclonal Anti-CCNA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL |
CCNA2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human CCNA2 |
Cyclin A2 (CCNA2) mouse monoclonal antibody, clone CY-28, Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti Cyclin A Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |