TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TRPM8 mouse monoclonal antibody,clone OTI7A11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TRPM8 mouse monoclonal antibody,clone OTI7A11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Rabbit Polyclonal Antibody against TRPM8 (Center R536)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8. |
Rabbit Polyclonal TRPM8 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7] |
Rabbit Polyclonal Anti-TRPM8 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide SDVDGTTYDFAHC, corresponding to amino acid residues 917-929 of human TRPM8. 3rd extracellular loop. |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRPM8 |
TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal TRPM8 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8. |
Rabbit Polyclonal Antibody against TRPM8 (C-term C940)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 926-956 amino acids from the C-terminal region of human TRPM8. |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
TRPM8 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 76-106 amino acids from the N-terminal region of human TRPM8 |
Rabbit Polyclonal Antibody against TRPM8 (C-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1075-1104 amino acids from the C-terminal region of human TRPM8. |
Rabbit Polyclonal Anti-TRPM8 Antibody (Internal)
Applications | IHC |
Reactivities | Human (Predicted: Monkey, Bovine, Pig, Xenopus) |
Conjugation | Unconjugated |
Immunogen | TRPM8 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPM8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bat, Dog, Rabbit, Horse, Guinea pig, Turkey, Chicken, Armadillo, Platypus (100%); Galago, Marmoset, Bovine, Pig, Opossum, Xenopus (93%); Lizard (87%). |