Rabbit Polyclonal HIF-2 alpha Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Human, Fish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Lamin A (LMNA) mouse monoclonal antibody, clone R27, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Fish, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Conjugation | Unconjugated |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
USD 445.00
2 Weeks
Desmoplakin (DSP) (2115-2132) mouse monoclonal antibody, clone DP447, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Chicken, Fish, Human, Mouse, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
TAC1 guinea pig polyclonal antibody, Serum
| Applications | FC, IHC |
| Reactivities | Fish, Human, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Substance P conjugated to BSA |
Lamin A (LMNA) mouse monoclonal antibody, clone X167, Purified
| Applications | IF, WB |
| Reactivities | Bovine, Fish, Human, Xenopus |
| Conjugation | Unconjugated |
TAC1 rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Fish, Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |
VIP rabbit polyclonal antibody, Serum
| Applications | IHC |
| Reactivities | Feline, Fish, Human, Mammalian, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified porcine VIP. |
Germany
Japan
United Kingdom
China
