Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC |
Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV |
Germany
Japan
United Kingdom
China
