Primary Antibodies

View as table Download

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Mouse, Rat, Human, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5

Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V).
Modifications Phospho-specific

Rabbit anti Claudin 5 Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated