Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CCR8 Rabbit polyclonal Antibody
| Applications | FC, IF, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CCR8 |
Rabbit Polyclonal Anti-CCR8 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Elephant, Panda (83%). |
Rabbit Polyclonal CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Rabbit Polyclonal Anti-CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
CCR8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 296-355 of human CCR8 (NP_005192.1). |
| Modifications | Unmodified |
CCR8 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to amino acids 183 to 201 of human CDw198 (CCR8). |
Rabbit anti CCR8 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |