Rabbit Polyclonal Anti-CASZ1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CASZ1 |
Rabbit Polyclonal Anti-CASZ1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CASZ1 |
CASZ1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CASZ1 antibody was raised against synthetic peptide corresponding to region near the amino terminal end of human Cas5 protein according to accession number CAI22571 |
CASZ1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1581-1609 amino acids from the C-terminal region of human CASZ1 |
Rabbit polyclonal anti-CASZ1 antibody
Applications | WB |
Reactivities | Human, Mouse, Drosophila, Chimpanzee, Macaque |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein. |
Rabbit Polyclonal Anti-CASZ1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA |
RGD1563533 Antibody - middle region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |