Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CASZ1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASZ1

CASZ1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen CASZ1 antibody was raised against synthetic peptide corresponding to region near the amino terminal end of human Cas5 protein according to accession number CAI22571

CASZ1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1581-1609 amino acids from the C-terminal region of human CASZ1

Rabbit polyclonal anti-CASZ1 antibody

Applications WB
Reactivities Human, Mouse, Drosophila, Chimpanzee, Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein.

Rabbit Polyclonal Anti-CASZ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA

RGD1563533 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated