Primary Antibodies

Jump to Filters
View as table Download
BPNT1 (C-term) Rabbit Polyclonal Antibody
AP50387PU-N

USD 580.00

2 Weeks

BPNT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human BPNT1
BPNT1 Goat Polyclonal Antibody
TA303272

USD 520.00

5 Days

Goat Polyclonal Antibody against BPNT1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4.
BPNT1 Rabbit Polyclonal Antibody
TA344274

USD 539.00

5 Days

Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP