Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SETD2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SETD2

Rabbit Polyclonal Anti-SETD2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETD2 antibody: synthetic peptide directed towards the N terminal of human SETD2. Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD