Primary Antibodies

View as table Download

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA