HRH2 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | FC, IF, PEP-ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the C-Terminus of the protein sequence according to NP_071640.1; NP_001124527.1. |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit polyclonal anti-HRH2 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HRH2. |
Rabbit Polyclonal Anti-HRH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HRH2 |
Goat Anti-Histamine Receptor H2 (aa309-323) Antibody
| Applications | PEP-ELISA, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SHNSHKTSLRLNNS, from the internal region of the protein sequence according to NP_001399939.1; NP_001010973.1. |
Rabbit Polyclonal Anti-HRH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HRH2 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH2. Synthetic peptide located within the following region: DFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQ |
HRH2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 188-218 amino acids from the Central region of human Histamine H2 receptor |
HRH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HRH2 |
HRH2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HRH2 (NP_001124527.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
