Primary Antibodies

Jump to Filters
View as table Download
CMA1 Rabbit Polyclonal Antibody
TA342809

USD 539.00

5 Days

Rabbit Polyclonal Anti-CMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA
CMA1 (96-110) Goat Polyclonal Antibody
AP23108PU-N

USD 555.00

2 Weeks

CMA1 (96-110) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human CMA1 / Mast Cell Chymase (NP_001827.1)
CMA1 Goat Polyclonal Antibody
TA311216

USD 520.00

5 Days

Goat Anti-CMA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QFRHPKYNTSTLHHD, from the internal region of the protein sequence according to NP_001827.1.