Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 150 and 423 of MPI (Uniprot ID#P34949) |
Rabbit Polyclonal antibody to PGM3 (phosphoglucomutase 3)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 44 and 321 of PGM3 (Uniprot ID#O95394) |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Rabbit polyclonal antibody to FPGT (fucose-1-phosphate guanylyltransferase)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Dog, Monkey, Pig, Rabbit, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 453 of FPGT (Uniprot ID#O14772) |
Rabbit Polyclonal Anti-HEXA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
Germany
Japan
United Kingdom
China
