Rabbit Polyclonal TRBP Antibody
Applications | IHC, WB |
Reactivities | Human, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 340-390 of human TRBP was used as the immunogen. |
Rabbit Polyclonal TRBP Antibody
Applications | IHC, WB |
Reactivities | Human, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 340-390 of human TRBP was used as the immunogen. |
Rabbit Polyclonal Anti-TARBP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TARBP2 antibody: synthetic peptide directed towards the N terminal of human TARBP2. Synthetic peptide located within the following region: ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT |