Rabbit polyclonal anti-SUCNR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
Rabbit polyclonal anti-SUCNR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
Rabbit Polyclonal Anti-SUCNR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1 |
Rabbit Polyclonal Anti-SUCNR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI |