Primary Antibodies

View as table Download

Rabbit polyclonal anti-SUCNR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SUCNR1.

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI