Primary Antibodies

View as table Download

LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-Loxl2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated