LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Loxl2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |