Primary Antibodies

Jump to Filters
View as table Download
Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF503813

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) HMOX2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI4H8]
TA503925

USD 447.00

In Stock

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MMAB Mouse Monoclonal Antibody [Clone ID: OTI4D12]
TA502166

USD 447.00

In Stock

MMAB mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MMAB Mouse Monoclonal Antibody [Clone ID: OTI4D12]
CF502166

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) MMAB mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody
TA348005

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-HO-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1
Ceruloplasmin (CP) Rabbit Polyclonal Antibody
TA324926

USD 580.00

2 Weeks

Rabbit polyclonal CP Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 547-577 amino acids from the Central region of human CP.
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 365.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody
TA327035

USD 365.00

3 Weeks

Rabbit anti-HMOX1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HMOX1
Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI4H8]
TA503925S

USD 200.00

2 Days

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA321426

USD 380.00

2 Weeks

Anti-FTH1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Mitochondrial Ferritin (FTMT) Rabbit Polyclonal Antibody
TA331204

USD 539.00

5 Days

Rabbit Polyclonal Anti-FTMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FTMT antibody is: synthetic peptide directed towards the middle region of Human FTMT. Synthetic peptide located within the following region: AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK
Heme Oxygenase 1 (HMOX1) (Center) Rabbit Polyclonal Antibody
AP52064PU-N

USD 580.00

2 Weeks

Heme Oxygenase 1 (HMOX1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of Human Heme oxygenase 1 / HMOX1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 539.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR