Primary Antibodies

View as table Download

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Glucose 6 Phosphate Dehydrogenase Antibody (2H7) Cytosol Marker

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336922 is a replacement of AM06697SU-N.

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908)

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG