NR4A3 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR4A3 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 564.00
In Stock
PR (PgR) mouse monoclonal antibody,clone UMAB137
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NR4A3 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
In Stock
PR (PgR) mouse monoclonal antibody,clone UMAB135
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
NR3C1 mouse monoclonal antibody, clone OTI6A12 (formerly 6A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR4A3 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit polyclonal GR (Ab-211) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |