Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Goat Anti-ALOX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3. |
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-THAS antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human THAS. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4. |
Rabbit polyclonal Cytochrome P450 4F2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
Rabbit polyclonal Cytochrome P450 2U1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2U1. |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon (Predicted: Bovine, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Rabbit polyclonal anti-Cox-3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide mapping to the N-terminus of mouse Cox-3 |
Rabbit Polyclonal Cox1 (PTGS1) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cox1 |
Rabbit Polyclonal Cox2 (PTGS2) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cox2 |
Germany
Japan
United Kingdom
China