Primary Antibodies

Jump to Filters
View as table Download
CYP2R1 Rabbit Polyclonal Antibody
TA316046

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2R1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1.
CYP2R1 (C-term) Rabbit Polyclonal Antibody
AP14746PU-N

USD 580.00

2 Weeks

CYP2R1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2R1.
CYP2R1 Rabbit Polyclonal Antibody
AP14747PU-N

USD 580.00

2 Weeks

CYP2R1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human CYP2R1.
CYP2R1 Rabbit Polyclonal Antibody
TA338658

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL
CYP2R1 Rabbit Polyclonal Antibody
TA338659

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG
CYP2R1 Rabbit Polyclonal Antibody
TA375289

USD 365.00

3 Weeks

CYP2R1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 252-501 of human CYP2R1 (NP_078790.2).
Modifications Unmodified