Rabbit polyclonal Cytochrome P450 2R1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1. |
Rabbit polyclonal Cytochrome P450 2R1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1. |
CYP2R1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2R1. |
CYP2R1 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human CYP2R1. |
Rabbit Polyclonal Anti-CYP2R1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL |
Rabbit Polyclonal Anti-CYP2R1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG |
CYP2R1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 252-501 of human CYP2R1 (NP_078790.2). |
Modifications | Unmodified |