UROD mouse monoclonal antibody,clone OTI2G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UROD mouse monoclonal antibody,clone OTI2G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UROD mouse monoclonal antibody,clone OTI2G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UROD mouse monoclonal antibody,clone OTI2G7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
UROD mouse monoclonal antibody,clone OTI2G7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-UROD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UROD antibody: synthetic peptide directed towards the N terminal of human UROD. Synthetic peptide located within the following region: SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV |
Rabbit anti-UROD Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UROD |
UROD mouse monoclonal antibody,clone OTI2G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |