USD 447.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLS2 mouse monoclonal antibody,clone OTI4C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 200.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLS2 mouse monoclonal antibody,clone OTI1C12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI4C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone UMAB281
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone UMAB282
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GLS2 mouse monoclonal antibody,clone OTI4C10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLS2 mouse monoclonal antibody,clone OTI4C10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB281
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB282
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |