Rabbit Polyclonal Anti-FGF17 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGF17 |
Rabbit Polyclonal Anti-FGF17 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGF17 |
Rabbit Polyclonal Anti-FGF17 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF17 antibody is: synthetic peptide directed towards the middle region of Human FGF17. Synthetic peptide located within the following region: KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL |