Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GRK5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG

Rabbit polyclonal GRK5 Antibody (C-term)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This GRK5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 559-590 amino acids from the C-terminal region of human GRK5.

Rabbit Polyclonal anti-GRK5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRK5

Rabbit Polyclonal anti-GRK5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRK5

Rabbit polyclonal anti-GRK5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRK5.

Rabbit Polyclonal Anti-GRK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK5 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK5. Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS