Primary Antibodies

View as table Download

AMSH (STAMBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 362-391 amino acids from the C-terminal region of Human STAMBP

Rabbit Polyclonal Anti-STAMBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAMBP antibody: synthetic peptide directed towards the N terminal of human STAMBP. Synthetic peptide located within the following region: SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS

STAMBP Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

STAMBP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human STAMBP